PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG005371t1
Common NameTCM_005371
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family MYB
Protein Properties Length: 321aa    MW: 35325.8 Da    PI: 6.6091
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG005371t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.6e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+W +eEde+lv+++k++G g+W++ ++  g+ R++k+c++rw +yl
  Thecc1EG005371t1 14 KGPWAPEEDEILVNYIKKHGHGSWRSLPKLAGLLRCGKSCRLRWTNYL 61
                      79******************************99************97 PP

2Myb_DNA-binding482.9e-1567112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++T eE++l ++++  lG++ W++Ia+ ++ gRt++++k+ w+++l
  Thecc1EG005371t1  67 RGPFTLEEEKLVIQLHGILGNR-WAAIASQLP-GRTDNEIKNLWNTHL 112
                       89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.7E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.947961IPR017930Myb domain
SuperFamilySSF466892.21E-3011108IPR009057Homeodomain-like
SMARTSM007172.1E-131363IPR001005SANT/Myb domain
PfamPF002491.7E-151461IPR001005SANT/Myb domain
CDDcd001673.04E-111661No hitNo description
PROSITE profilePS5129424.53962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-2565117IPR009057Homeodomain-like
SMARTSM007173.0E-1466114IPR001005SANT/Myb domain
PfamPF002494.1E-1467112IPR001005SANT/Myb domain
CDDcd001675.88E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MGRTPCCDRK GLKKGPWAPE EDEILVNYIK KHGHGSWRSL PKLAGLLRCG KSCRLRWTNY  60
LRPDIKRGPF TLEEEKLVIQ LHGILGNRWA AIASQLPGRT DNEIKNLWNT HLKKRLVCMG  120
LDPQTHEPFT PCGPTTAAPT SPATRHMAQW ESARLEAEAR LSRESLLFSS PPLGKPDSDY  180
FLRLWNSEVG ESFRKLNRED KTACQSPISQ ASSSTKCGSV SAVTIDICPN IAGSSTPASN  240
QIEDTACKSF KSCTEDPVDA SDSSCSNESE DSSDTALQLL LDFPINNDMS FLENVDTYAT  300
SHAMLTDTSF ISPSEGYLKA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-29121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00114ampDAPTransfer from AT3G61250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4591697e-44AJ459169.1 Gossypium hirsutum partial myb139 gene, clone pGhMYB139.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007051856.10.0Myb domain protein 17 isoform 1
TrEMBLA0A061E1590.0A0A061E159_THECC; Myb domain protein 17 isoform 1
STRINGPOPTR_0014s07700.11e-172(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69822643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-121myb domain protein 17
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]